PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 200aa    MW: 22012.1 Da    PI: 10.039
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015726genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.42.1e-242368146
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                 k+ien+ nr+vtfskR+ g++KKA ELS+LC+a+vaviifs + k+
  Lus10015726 23 KKIENDANRYVTFSKRKSGLFKKATELSTLCGAQVAVIIFSGHHKV 68
                 68***************************************88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.7491575IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-331574IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-281688IPR002100Transcription factor, MADS-box
CDDcd002654.96E-341687No hitNo description
PRINTSPR004041.5E-201737IPR002100Transcription factor, MADS-box
PfamPF003194.6E-242470IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-203752IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-205273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MTSGAAGKKA KKPSKGRQKI EIKKIENDAN RYVTFSKRKS GLFKKATELS TLCGAQVAVI  60
IFSGHHKVFS CGRPDVDSVL RRYQLHSPNL TLNPNNNDRR GNAVNYSDCK ASFGIDNVIM  120
ASRESVQKQE YVKAVKMLEE GKRHVAAQAG LGDPTTVSGG FWWEDWAVDA MEEKDQVQSC  180
KESLMELKEK VSARLGSMG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-181683168Myocyte-specific enhancer factor 2A
3mu6_C9e-181683168Myocyte-specific enhancer factor 2A
3mu6_B9e-181683168Myocyte-specific enhancer factor 2A
3mu6_A9e-181683168Myocyte-specific enhancer factor 2A
1egw_D1e-171683168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-171683168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-171683168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-171683168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-171683168Myocyte-specific enhancer factor 2A
3p57_I1e-171683168Myocyte-specific enhancer factor 2A
3p57_D1e-171683168Myocyte-specific enhancer factor 2A
3p57_C1e-171683168Myocyte-specific enhancer factor 2A
3p57_B1e-171683168Myocyte-specific enhancer factor 2A
3p57_A1e-171683168Myocyte-specific enhancer factor 2A
3kov_J1e-171683168Myocyte-specific enhancer factor 2A
3kov_I1e-171683168Myocyte-specific enhancer factor 2A
3kov_B1e-171683168Myocyte-specific enhancer factor 2A
3kov_A1e-171683168Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-25AGAMOUS-like 62